Results for “hospital recovery room22,004 images

Family Decorating Christmas Tree at Dusk

Family Decorating Christmas Tree at Dusk

해질녘 크리스마스트리를 꾸미는 가족

familychristmas treeholidayliving room
Olive Branch Peace Wreath in Prayer Room

Olive Branch Peace Wreath in Prayer Room

기도실의 올리브 가지 평화 화환

olive branchpeace symbolevergreen wreathprayer room
Wheelchair User Leading Group Discussion

Wheelchair User Leading Group Discussion

휠체어 사용자가 이끄는 그룹 토론

wheelchairdisabilitygroup discussionliving room
Emotional First Embrace in Visitation Room

Emotional First Embrace in Visitation Room

면회실에서의 감동적인 첫 포옹

emotional embracefirst meetingmother and childvisitation room
Korean Pastor Counseling Young Couple Indoors

Korean Pastor Counseling Young Couple Indoors

실내에서 젊은 부부를 상담하는 한국인 목사

korean pastorcounselingyoung coupleoffice interior
Warm Small Group Fellowship Food Table

Warm Small Group Fellowship Food Table

따뜻한 소그룹 교제 음식 테이블

small groupfellowshipfood tablepizza
Children Crafting in Bright Summer Classroom

Children Crafting in Bright Summer Classroom

밝은 여름 교실에서 만들기하는 아이들

childrenclassroomcraftsummer
Supportive Friends Group Hug From Above

Supportive Friends Group Hug From Above

위에서 본 친구들의 따뜻한 포옹

group hugfriendssupportencouragement
Baptism Certificate with Cross and Water

Baptism Certificate with Cross and Water

십자가와 물이 있는 세례 증서

baptism certificatecrosswater bowlshell
Asian Women Bible Study Tea Fellowship

Asian Women Bible Study Tea Fellowship

아시아 여성들의 성경 공부 티 모임

asian womenbible studytea fellowshipsmall group
Underground Wine Cellar with Stone Barrels

Underground Wine Cellar with Stone Barrels

석조 배럴이 있는 지하 와인 셀러

wine cellarunderground interiorstone wallsoak barrels
Elderly Man by Rainy Window Portrait

Elderly Man by Rainy Window Portrait

비 오는 창가의 노년 남성 초상

elderly mansenior portraitclose upwistful expression
Intimate House Church Worship at Dusk

Intimate House Church Worship at Dusk

해 질 녘 가정교회 예배 모임

house churchliving room worshipintimate prayerchristian community
Quiet Blue Christmas Candle Remembrance Service

Quiet Blue Christmas Candle Remembrance Service

고요한 블루 크리스마스 추모 예배 촛불 장면

blue christmasremembrance servicecandlesgrief
Gentle Church Nursery Volunteer Holding Baby

Gentle Church Nursery Volunteer Holding Baby

아기를 안고 있는 교회 탁아 봉사자

church nurserynursery volunteerholding babychildcare ministry
Hispanic Church Congregation Singing in Sunlight

Hispanic Church Congregation Singing in Sunlight

햇살 속에서 찬양하는 히스패닉 교회 회중

hispanic congregationlatino familychurch interiorsinging
Grandfather Sharing Bible Story with Grandchildren

Grandfather Sharing Bible Story with Grandchildren

할아버지가 손주들과 나누는 성경 이야기

grandfathergrandchildrenbible storyfamily devotion
Business Presentation in Modern Conference Room

Business Presentation in Modern Conference Room

현대적인 회의실의 비즈니스 프레젠테이션

business presentationconference roomteam meetingpresenter
Determined Athlete Close-Up Before Competition

Determined Athlete Close-Up Before Competition

경기 전 결연한 선수의 클로즈업

athleteportraitcloseupdetermined
Peaceful Weekend Home Cleaning Scene

Peaceful Weekend Home Cleaning Scene

평온한 주말 집안 청소 장면

cleaning housemop buckettidy homepeaceful morning
Man Kneeling Alone in Church Sanctuary

Man Kneeling Alone in Church Sanctuary

교회 예배당에서 홀로 무릎 꿇은 남성

church sanctuarykneeling manprayerwooden pew
Business Brainstorm Whiteboard Presentation Concept

Business Brainstorm Whiteboard Presentation Concept

비즈니스 브레인스토밍 화이트보드 프레젠테이션 콘셉트

presentation whiteboardteam brainstormbusiness strategycollaboration
Post Workout Protein Shake and Fresh Fruits

Post Workout Protein Shake and Fresh Fruits

운동 후 단백질 쉐이크와 신선한 과일

protein shakepost workoutfresh fruitswellness
Neighbors Comforting Family in Living Room

Neighbors Comforting Family in Living Room

거실에서 가족을 위로하는 이웃들

griefsupportfamilyneighbors
Family Praying Before Thanksgiving Dinner Together

Family Praying Before Thanksgiving Dinner Together

추수감사절 저녁 식사 전 함께 기도하는 가족

familythanksgivingdinnerprayer
Young Couple Praying Together at Home

Young Couple Praying Together at Home

집에서 함께 기도하는 젊은 커플

young coupleprayingholding handsinterracial couple
Parent Preparing Supplies in Community Room

Parent Preparing Supplies in Community Room

커뮤니티 룸에서 준비물을 정리하는 부모

parentvolunteercommunity roomchurch interior
Joyful Filipino Family Dining Room Portrait

Joyful Filipino Family Dining Room Portrait

즐거운 필리핀 가족의 다이닝룸 초상

filipino familymultigenerational familyfamily portraitdining room
Warm Retro Vinyl Turntable Living Room

Warm Retro Vinyl Turntable Living Room

따뜻한 레트로 감성의 턴테이블 거실

vinyl record playerturntableretrowarm light
Calm Young Woman in Sunlit Yoga Studio

Calm Young Woman in Sunlit Yoga Studio

햇살 드는 요가 스튜디오의 차분한 젊은 여성

young womansouth asian womanyoga studioclose up portrait
Hispanic Family Birthday Celebration at Home

Hispanic Family Birthday Celebration at Home

집에서 생일을 축하하는 히스패닉 가족

hispanic familybirthday partymultigenerationalgrandmother
Single Candle of Courage in Darkness

Single Candle of Courage in Darkness

어둠 속 용기를 비추는 하나의 촛불

single candlecouragedarknesshope
Grateful Family Gathering at Dining Table

Grateful Family Gathering at Dining Table

식탁에 모인 감사한 가족 모임

familydining tablemultigenerationalgrateful woman
Compassionate Social Worker in Community Office

Compassionate Social Worker in Community Office

커뮤니티 사무실의 따뜻한 사회복지사

social workerportraitblack womancommunity center
Young Man Helping Elderly Woman Indoors

Young Man Helping Elderly Woman Indoors

실내에서 노인을 돕는 젊은 남성

young manlatino manelderly womanhelping
Modern Office Bookshelf of Knowledge and Wisdom

Modern Office Bookshelf of Knowledge and Wisdom

지혜와 통찰을 담은 현대적 사무실 책장

bookshelfmodern officeknowledgewisdom
Morning Stretch on Lavender Yoga Mat

Morning Stretch on Lavender Yoga Mat

라벤더 요가 매트 위의 아침 스트레칭

stretching exercisesyoga matmorning lightwellness
Joyful Man Laughing in Warm Light

Joyful Man Laughing in Warm Light

따뜻한 빛 속 환하게 웃는 남성

joyful manlaughingclose up portraitblack man
Colorful Stained Glass Light in Hall

Colorful Stained Glass Light in Hall

홀 안에 비친 화려한 스테인드글라스 빛

stained glasscolorful lightarched windowsinterior hall
Peaceful Waiting Room with Clock and Chair

Peaceful Waiting Room with Clock and Chair

시계와 의자가 있는 평온한 대기실

patiencewaiting roomclockpeace