Results for “cream quilt20,515 images

Modern Laptop Workspace with Warm Daylight

Modern Laptop Workspace with Warm Daylight

따뜻한 햇살이 비치는 현대적인 노트북 작업 공간

laptopworkspacemodern officetechnology
Fresh Turkish Coffee in Copper Pot

Fresh Turkish Coffee in Copper Pot

구리 포트에 담긴 신선한 터키식 커피

turkish coffeecopper potcoffee foamartisanal
African American Gospel Choir Singing in Sanctuary

African American Gospel Choir Singing in Sanctuary

예배당에서 노래하는 아프리카계 미국인 가스펠 합창단

african americangospel choirchoir robeschurch sanctuary
Quiet Morning Devotion with Bible App

Quiet Morning Devotion with Bible App

성경 앱과 함께하는 고요한 아침 묵상

morning devotionbible appsmartphoneearbuds
Tearful Prayer Comfort Near Rainy Window

Tearful Prayer Comfort Near Rainy Window

비 오는 창가에서 위로받는 눈물의 기도

tear on cheekcomfortprayer cornergrief
Child Coloring Bible Story Activity Page

Child Coloring Bible Story Activity Page

성경 이야기 활동지를 색칠하는 아이

children coloringbible storyactivity pagesunday school
Church Welcome Team Training Orientation Scene

Church Welcome Team Training Orientation Scene

교회 안내팀 교육 오리엔테이션 장면

church welcome teamvolunteer trainingchurch orientationfellowship room
Toddler Taking First Steps to Parents

Toddler Taking First Steps to Parents

부모에게 첫걸음 내딛는 아기

toddlerfirst stepsparentsfamily
Multicultural Congregation Singing in Wooden Sanctuary

Multicultural Congregation Singing in Wooden Sanctuary

나무 예배당에서 함께 찬양하는 다문화 성도들

multicultural congregationsinging togetherwooden sanctuarypeaceful
Family Holding Hands at Thanksgiving Dinner

Family Holding Hands at Thanksgiving Dinner

추수감사절 저녁 식사 전 손을 맞잡은 가족

thanksgivingfamilydinnerprayer
Soft Fabric Swatches for Fashion Design

Soft Fabric Swatches for Fashion Design

패션 디자인을 위한 부드러운 원단 스와치

fabric swatchescolor samplesfashion designtextile texture
Friendly Teacher Portrait in Bright Classroom

Friendly Teacher Portrait in Bright Classroom

밝은 교실 속 친근한 교사 초상

teacherportraitwomanclassroom
Elegant Straw Hat and Sunglasses by Shore

Elegant Straw Hat and Sunglasses by Shore

해변가의 우아한 밀짚모자와 선글라스

straw hatsunglassesbeach fashionsummer accessories
Calm Blood Pressure Check in Community Clinic

Calm Blood Pressure Check in Community Clinic

지역 클리닉의 차분한 혈압 측정

blood pressurehealth checkcommunity clinicclinician hands
Beach Umbrella Chairs Overlooking Blue Ocean

Beach Umbrella Chairs Overlooking Blue Ocean

푸른 바다를 바라보는 비치 파라솔과 의자

beach umbrellalounge chairsocean viewsummer travel
Children Choosing Christmas Gifts in Church Hall

Children Choosing Christmas Gifts in Church Hall

교회 홀에서 크리스마스 선물을 고르는 아이들

christmastoy drivechurch hallchildren
Post Workout Protein Shake and Fresh Fruits

Post Workout Protein Shake and Fresh Fruits

운동 후 단백질 쉐이크와 신선한 과일

protein shakepost workoutfresh fruitswellness
Peaceful Rest in White Sheets

Peaceful Rest in White Sheets

하얀 침구 속 평온한 휴식

sleepingrestrecoverywhite sheets
Warm Headshot of Smiling Woman Teacher

Warm Headshot of Smiling Woman Teacher

따뜻한 미소의 여성 교사 인물사진

headshotportraitsmiling womanblack woman
Quiet Church Nursery with Morning Light

Quiet Church Nursery with Morning Light

아침빛이 머무는 조용한 교회 유아실

church nurserynursery toyschildren ministrysoft light
House Church Gathering in Cozy Living Room

House Church Gathering in Cozy Living Room

아늑한 거실의 가정교회 모임

house churchliving roomworship gatheringprayer group
Boat on Calm Lake Morning Mist

Boat on Calm Lake Morning Mist

아침 물안개 속 고요한 호수의 배

boatcalm lakemorning mistdawn
Communion Preparation Table in Quiet Church Room

Communion Preparation Table in Quiet Church Room

고요한 교회 공간의 성찬 준비 테이블

communion tablechurch fellowship roomcommunion preparationbread and cup
Jesus Breaking Bread Last Supper Still Life

Jesus Breaking Bread Last Supper Still Life

최후의 만찬 떡을 떼시는 예수 정물

jesus breaking breadlast suppercommunioneucharist
Joyful Corgi Puppy Running Through Summer Grass

Joyful Corgi Puppy Running Through Summer Grass

여름 풀밭을 달리는 사랑스러운 코기 강아지

corgipuppydog runninggrass field
Weekly Scripture Memory Verse Card Scene

Weekly Scripture Memory Verse Card Scene

주간 성경 암송 구절 카드 장면

weekly scripturememory versedevotional cardnotebook stack
Curious Kitten Playing by Yarn Tunnel

Curious Kitten Playing by Yarn Tunnel

실 터널 앞에서 노는 호기심 많은 아기 고양이

kittencatyarn ballplay tunnel
Sign Language Worship in Contemporary Sanctuary

Sign Language Worship in Contemporary Sanctuary

현대적 예배당의 수어 예배 장면

deaf ministrysign languagechurch serviceinterpreter
Quiet Outdoor River Baptism Family Moment

Quiet Outdoor River Baptism Family Moment

고요한 야외 강가 가족 세례의 순간

river baptismoutdoor baptismfamily baptismchurch life
Asian Women Sharing Tea at Home

Asian Women Sharing Tea at Home

집에서 차를 나누는 아시아 여성들

asian womenteadiscussionliving room
Styled Tray with Candle and Book

Styled Tray with Candle and Book

캔들과 책이 놓인 스타일드 트레이

styled traycandlebookeyeglasses
Reviving Pink Flower on Sunlit Windowsill

Reviving Pink Flower on Sunlit Windowsill

햇살 비치는 창가의 되살아나는 분홍 꽃

reviving flowerwilted flowerwater dropspink flower
Dwarf Hamster in Exercise Wheel Close-Up

Dwarf Hamster in Exercise Wheel Close-Up

운동 바퀴 안의 드워프 햄스터 클로즈업

hamsterdwarf hamsterexercise wheelsmall pet
Cozy Autumn Outfit Flat Lay

Cozy Autumn Outfit Flat Lay

아늑한 가을 옷차림 플랫레이

autumn outfitcozy flat layknit sweaterplaid scarf
Smiling Father Holding Baby in Nursery

Smiling Father Holding Baby in Nursery

아기를 안고 있는 미소 짓는 아버지

fatherbabydaughterfamily
Outdoor Farmers Market Fresh Produce Stand

Outdoor Farmers Market Fresh Produce Stand

야외 파머스 마켓 신선 농산물 매대

farmers marketfresh produceoutdoor marketvegetables
Outdoor Concert Crowd at Sunset

Outdoor Concert Crowd at Sunset

노을 속 야외 콘서트 군중

outdoor concertsunsetcrowdraised hands
Spring Flowers and Seedlings Flat Lay

Spring Flowers and Seedlings Flat Lay

봄꽃과 새싹이 있는 플랫레이

springflat layflowerstulips
Wood Dove Ornament on Evergreen Branches

Wood Dove Ornament on Evergreen Branches

상록수 가지에 걸린 나무 비둘기 장식

wood dovedove ornamentevergreen brancheschristmas tree
Elegant Modern Dining Room with Violet Hydrangeas

Elegant Modern Dining Room with Violet Hydrangeas

보랏빛 수국이 있는 우아한 모던 다이닝룸

dining roomelegant interiormodern dining tablecream chairs
Page 1 of 513Next →