Results for “prism light107,610 images

Young Woman Looking Up in Sunlight

Young Woman Looking Up in Sunlight

햇살 아래 위를 바라보는 젊은 여성

young womanlatina womanclose up portraitlooking up
Youth Retreat Bible Discussion in Rustic Cabin

Youth Retreat Bible Discussion in Rustic Cabin

소박한 산장 안의 청소년 수련회 성경 나눔

youth retreatbible discussionrustic cabinsmall group
Biracial Teen Portrait in Creative Studio

Biracial Teen Portrait in Creative Studio

창작 스튜디오의 혼혈 십대 초상

biracial teenagerteen portraitcreative studiocurly hair
Young Woman Journaling by Coffee Shop Window

Young Woman Journaling by Coffee Shop Window

카페 창가에서 일기를 쓰는 젊은 여성

young womanjournalingcoffee shopwindow light
Palm Branches on Misty Stone Path

Palm Branches on Misty Stone Path

안개 낀 돌길 위의 종려나무 가지

palm branchesstone pathpalm sundayseasonal
Serene Cliff Path Above Blue Ocean

Serene Cliff Path Above Blue Ocean

푸른 바다 위 고요한 절벽길

cliff edgeocean horizongrassy ridgedawn light
Ocean Waves Crashing on Rocky Shore

Ocean Waves Crashing on Rocky Shore

바위 해안에 부딪히는 거센 파도

ocean wavesrocky shorecoastal landscapecalm energy
Church Youth Game Night in Gym

Church Youth Game Night in Gym

체육관에서 열린 교회 청소년 게임 나이트

church youthyouth groupgame nightgym
Beauty Vlog Desk with Ring Light

Beauty Vlog Desk with Ring Light

링라이트가 있는 뷰티 브이로그 데스크

ring lightcamera setupvlog deskbeauty creator
Three Carolers Singing on Snowy Porch

Three Carolers Singing on Snowy Porch

눈 덮인 현관에서 노래하는 세 명의 캐럴단

carolerssingingwintersnowy
Father Cooking Dinner with Two Children

Father Cooking Dinner with Two Children

두 아이와 저녁을 준비하는 아버지

fatherchildrenfamilycooking
Satellite Dish Under Clear Blue Sky

Satellite Dish Under Clear Blue Sky

맑은 푸른 하늘 아래 위성 안테나

satellite dishcommunicationtechnologyblue sky
Stormy Sea with Dark Clouds

Stormy Sea with Dark Clouds

먹구름 아래 거친 폭풍의 바다

stormy seadark cloudsdramatic wavescoastal landscape
Woman Cradling Sleepy Baby in Nursery

Woman Cradling Sleepy Baby in Nursery

보육실에서 졸린 아기를 안고 있는 여성

womanbabyinfantnursery
Secure Online Payment at Modern Desk

Secure Online Payment at Modern Desk

현대적인 책상에서의 안전한 온라인 결제

online paymentcredit cardlaptopecommerce
Fresh Spring Leaves in Morning Light

Fresh Spring Leaves in Morning Light

아침 햇살에 빛나는 봄 새잎

spring leavesnew growthfresh greenrenewal
Hispanic Family Holding Hands at Dinner

Hispanic Family Holding Hands at Dinner

식탁에서 손을 맞잡은 히스패닉 가족

hispanic familyfamily dinnerprayerjoined hands
Coworkers Holding Hands in Office Prayer

Coworkers Holding Hands in Office Prayer

사무실에서 손을 맞잡고 기도하는 동료들

coworkersprayerofficegroup
Bassist on Purple Lit Church Stage

Bassist on Purple Lit Church Stage

보랏빛 조명의 교회 무대 위 베이시스트

bassistbass guitarchurch stageworship band
Sunday Morning Church Bell Tower Glow

Sunday Morning Church Bell Tower Glow

주일 아침 햇살 속 교회 종탑

church bell towersunday morningchurch lifebrick church
Robotic Arm in Modern Automated Factory

Robotic Arm in Modern Automated Factory

현대 자동화 공장의 로봇 팔

robot armfactory automationmodern factoryindustrial technology
Water to Wine Miracle at Cana

Water to Wine Miracle at Cana

가나의 물이 포도주로 변한 기적

jesus at canawater to winecana miraclebiblical narrative
Glass Jar Coin Savings Growth on Desk

Glass Jar Coin Savings Growth on Desk

책상 위 유리병 동전 저축 성장

glass jarcoinssavings growthfinancial stewardship
Post Workout Protein Shake with Fresh Fruits

Post Workout Protein Shake with Fresh Fruits

운동 후 신선한 과일과 단백질 쉐이크

protein shakepost workoutfresh fruitsfitness nutrition
Soft Morning Light in Church Nursery

Soft Morning Light in Church Nursery

부드러운 아침빛이 드는 교회 유아실

church nurserynursery toyssoft lightplush lamb
Elegant Espresso Cup on Business Desk

Elegant Espresso Cup on Business Desk

비즈니스 책상 위의 우아한 에스프레소 잔

espresso cupsaucerbusiness desklaptop
Christian Family Dinner Prayer Around Rustic Table

Christian Family Dinner Prayer Around Rustic Table

소박한 식탁에 둘러앉은 기독교 가족의 식사 기도

christian familydinner prayerholding handsgratitude
Slow Living Breakfast Tray with Cream Flowers

Slow Living Breakfast Tray with Cream Flowers

크림색 꽃과 함께한 슬로우 리빙 아침 트레이

breakfast trayslow livingwafflesflowers
Creative Professional Typing on Tablet Workspace

Creative Professional Typing on Tablet Workspace

태블릿으로 작업하는 크리에이티브 워크스페이스

tabletstyluscreative workbusiness workspace
Wooden Puzzle Pieces for Faithful Teamwork

Wooden Puzzle Pieces for Faithful Teamwork

신실한 협력을 상징하는 나무 퍼즐 조각

puzzle piecesteamworkunitycollaboration
Peaceful Meditation by Misty Forest Lake

Peaceful Meditation by Misty Forest Lake

안개 낀 숲속 호숫가의 평온한 묵상

meditationpeacefulcalm natureforest lake
Joyful African Church Choir in Morning Light

Joyful African Church Choir in Morning Light

아침 햇살 속 기쁨의 아프리카 교회 성가대

african church choirgospel singingcolorful robesmorning light
Rustic Pine Cone and Holly Winter Arrangement

Rustic Pine Cone and Holly Winter Arrangement

소박한 솔방울과 홀리 열매 겨울 장식

pine coneholly berrieswinter arrangementevergreen
Ruth and Naomi on Dusty Road

Ruth and Naomi on Dusty Road

먼지 길을 걷는 룻과 나오미

ruth and naomibiblical narrativeold testamentloyalty
Happy Senior Couple with Morning Coffee

Happy Senior Couple with Morning Coffee

아침 커피를 함께하는 행복한 노년 부부

senior couplemorning coffeeelderly couplekitchen nook
Church Choir Rehearsal in Red Robes

Church Choir Rehearsal in Red Robes

붉은 성가대복을 입은 교회 성가대 연습

church choirchoir robeschoir rehearsalchurch life
Multicultural Community Potluck in Fellowship Hall

Multicultural Community Potluck in Fellowship Hall

친교실의 다문화 공동체 포트럭

potluckcommunitymulticulturalfellowship hall
Teen Crowd Raising Hands at Concert

Teen Crowd Raising Hands at Concert

콘서트에서 손을 든 십대 관중

teenagersconcert crowdraised handsauditorium
Family Holding Hands Before Thanksgiving Dinner

Family Holding Hands Before Thanksgiving Dinner

추수감사절 저녁 식사 전 손을 맞잡은 가족

familythanksgivingdinnerprayer
Church Audio Engineer at Mixing Console

Church Audio Engineer at Mixing Console

믹싱 콘솔 앞의 교회 음향 엔지니어

sound mixing boardchurch audio engineerchurch technologyaudio console
Page 1 of 2691Next →