Results for “wooden rake58,249 images

Diverse Hands Planting a Young Tree

Diverse Hands Planting a Young Tree

어린 나무를 함께 심는 다양한 손길

hands planting treesaplingcommunity gardencreation care
Cozy Cabin Window Over Snowy Pines

Cozy Cabin Window Over Snowy Pines

눈 덮인 소나무를 바라보는 아늑한 오두막 창가

cozy cabincabin windowsnowy pineswinter landscape
Colorful Salmon Poke Bowl Overhead Scene

Colorful Salmon Poke Bowl Overhead Scene

감각적인 연어 포케볼 탑뷰 장면

salmon poke bowlavocadorice bowloverhead food
Warm Desk Lamp for Evening Focus

Warm Desk Lamp for Evening Focus

저녁 집중을 위한 따뜻한 책상 조명

desk lampevening workspacehome officebusiness
Autumn Harvest Festival at Countryside Chapel

Autumn Harvest Festival at Countryside Chapel

시골 예배당의 가을 추수 감사 축제

harvest festivalpumpkinsautumn churchcountryside chapel
Hands Holding Open Bible by Window

Hands Holding Open Bible by Window

창가에서 성경을 들고 있는 손

hands holding bibleopen bibleclose upevergreen
Confident Woman in Warm Afternoon Light

Confident Woman in Warm Afternoon Light

따뜻한 오후 빛 속 자신감 있는 여성

woman portraitnatural beautyconfident womandeep brown skin
Rainy Jungle Treehouse Lodge Boardwalk

Rainy Jungle Treehouse Lodge Boardwalk

비 내린 정글의 트리하우스 로지 산책로

treehouse lodgejungle canopytropical forestwooden boardwalk
Refreshing Citrus Infused Water Pitcher Close-Up

Refreshing Citrus Infused Water Pitcher Close-Up

상큼한 시트러스 인퓨즈드 워터 피처 클로즈업

citrus waterinfused waterglass pitcherorange slices
Presenter With Projection in Dark Auditorium

Presenter With Projection in Dark Auditorium

어두운 강당에서 프레젠테이션하는 발표자

presentation slideprojector screendark conference roombusiness conference
Post Workout Protein Shake with Fresh Fruits

Post Workout Protein Shake with Fresh Fruits

운동 후 신선한 과일과 단백질 쉐이크

protein shakepost workoutfresh fruitswellness fitness
Young Man Singing with Eyes Closed

Young Man Singing with Eyes Closed

눈을 감고 노래하는 젊은 남성

young manblack mansingingeyes closed
Women Standing in Warm Worship Hall

Women Standing in Warm Worship Hall

따뜻한 예배당에 서 있는 여성들

womenworship hallpewsrear view
Teens Singing Around Forest Campfire

Teens Singing Around Forest Campfire

숲속 모닥불가에서 노래하는 청소년들

campfireteenagersforest clearingacoustic guitar
Women’s Bible Journaling Tea Fellowship

Women’s Bible Journaling Tea Fellowship

여성들의 성경 묵상과 티 펠로우십

women bible studysmall grouptea fellowshipbible journaling
Family Praying Before Thanksgiving Dinner

Family Praying Before Thanksgiving Dinner

추수감사절 식사 전 기도하는 가족

thanksgivingfamilyprayerdinner table
Open Bible Pages Turning in Evergreen Breeze

Open Bible Pages Turning in Evergreen Breeze

상록수 바람에 넘어가는 펼쳐진 성경

open biblebible pagesevergreen forestwinter breeze
Multicultural Family Portrait in Village Courtyard

Multicultural Family Portrait in Village Courtyard

마을 안뜰의 다문화 가족 초상

multicultural familyfamily portraitvillage courtyardoutdoor portrait
Easter Garden Path to Wooden Crosses

Easter Garden Path to Wooden Crosses

나무 십자가로 이어지는 부활절 정원 길

easter gardenlilieswooden crossresurrection
Midnight New Year Prayer Service in Church

Midnight New Year Prayer Service in Church

교회에서 열린 자정 신년 기도 예배

church interiorprayer servicemidnightnew year eve
Sparkling Lemon Berry Water in Sunlight

Sparkling Lemon Berry Water in Sunlight

햇살 속 레몬 베리 탄산수

lemon watersparkling waterberry drinkbrunch beverage
Four Men Sharing Breakfast Conversation

Four Men Sharing Breakfast Conversation

네 남성이 함께하는 아침 식사 대화

breakfastmenconversationfriends
Peaceful Lake Dock at Misty Morning

Peaceful Lake Dock at Misty Morning

안개 낀 아침의 평온한 호숫가 선착장

lake dockwooden pierpeaceful morningmisty horizon
Holy Monday Temple Cleansing at Dawn

Holy Monday Temple Cleansing at Dawn

새벽의 성전 정결, 거룩한 월요일

holy mondaytemple cleansingoverturned tablesholy week
Lavender Field at Sunrise with Basket

Lavender Field at Sunrise with Basket

바구니가 놓인 새벽 라벤더 밭

lavender fieldsunrisepurple flowerswoven basket
Woman Walking Garden Stone Path at Sunrise

Woman Walking Garden Stone Path at Sunrise

해 뜰 무렵 정원의 돌길을 걷는 여성

womangarden pathstepping stonessunrise
Campfire Prayer Gathering in Forest at Night

Campfire Prayer Gathering in Forest at Night

밤 숲속의 캠프파이어 기도 모임

campfirenightforestprayer
Wooden Cross Necklace in Morning Light

Wooden Cross Necklace in Morning Light

아침빛 속 나무 십자가 목걸이

cross necklacewooden crosschristian lifestylepeaceful faith
Organic Lip Balm Tin Beauty Ritual

Organic Lip Balm Tin Beauty Ritual

틴 케이스 오가닉 립밤 뷰티 루틴

organic lip balmlip balm tinnatural beautyskincare ritual
Family Reading Childrens Book on Sofa

Family Reading Childrens Book on Sofa

소파에서 어린이 책을 읽는 가족

familyparentschildgirl
Rustic Communion Table with Bread and Chalice

Rustic Communion Table with Bread and Chalice

빵과 성배가 놓인 소박한 성찬식탁

communion tablebread and winechaliceeucharist
Seniors Sharing Tea in Community Room

Seniors Sharing Tea in Community Room

공동체 공간에서 차를 나누는 어르신들

seniorstea timeconversationcommunity room
African American Pastor Preaching at Wooden Pulpit

African American Pastor Preaching at Wooden Pulpit

나무 강대상에서 설교하는 흑인 목회자

african american pastorpreachingbiblepulpit
Quiet Morning Reflection on Lakeside Dock

Quiet Morning Reflection on Lakeside Dock

호숫가 선착장에서 맞는 고요한 아침

person on docklakeside reflectioncalm lakesunrise
Elegant Church Pew Wedding Floral Decoration

Elegant Church Pew Wedding Floral Decoration

우아한 교회 벤치 웨딩 플라워 장식

church weddingpew flowerswedding decorationivory roses
Turkish Coffee Pour in Copper Pot

Turkish Coffee Pour in Copper Pot

구리 포트에 따르는 터키식 커피

turkish coffeecopper potcoffee foamartisanal drink
Warm Historic Library Reading Room Scene

Warm Historic Library Reading Room Scene

따뜻한 분위기의 고풍스러운 도서관 열람실

library reading roomhistoric librarybookshelvesstudent reading
Focused Tutoring Session with Books at Table

Focused Tutoring Session with Books at Table

책상에서 진행되는 집중 과외 시간

tutoring sessioneducationstudy tablebooks
Starry Alpine Lake With Milky Way Reflection

Starry Alpine Lake With Milky Way Reflection

은하수가 비치는 별빛 알프스 호수

starry nightalpine lakemountain reflectionmilky way
Gentle Elderly Woman by Sunlit Window

Gentle Elderly Woman by Sunlit Window

햇살 비치는 창가의 온화한 노인 여성

elderly womaneast asianportraitsenior
Page 1 of 1457Next →